Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj5g3v2017090.2
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family HD-ZIP
Protein Properties Length: 686aa    MW: 76123.8 Da    PI: 6.3821
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj5g3v2017090.2genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
         Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                      r++ +++t++q++eLe++F+++++p++++r +L+++lgL+ +qVk+WFqNrR+++k
                      789999***********************************************999 PP

            START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kaetl 82 
                      la++a++el+k+a+ ++p+W+ks+    e +n++e+ ++f++  +     + +ea+r++gv   ++  lve ++d + +W  +++    +a++l
                      6899**********************9999**********99988********************************.*******9999***** PP

            START  83 evissg.......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvtwve 168
                      +v+s g       galq+m ae q+lsplvp R + f+R+++q+ +g+w+++dvSv+   +  + ++++ +++lpSg+++++++ng+ kvtwve
                      *************************************************************999****************************** PP

            START 169 hvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                      h+++++++ h+l+r+l++ g+ +ga +w atlqrq e
                      **********************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007117.76798158IPR001356Homeobox domain
SMARTSM003898.1E-1999162IPR001356Homeobox domain
CDDcd000861.48E-19100158No hitNo description
PfamPF000468.6E-19101156IPR001356Homeobox domain
PROSITE patternPS000270133156IPR017970Homeobox, conserved site
PROSITE profilePS5084841.119302539IPR002913START domain
SuperFamilySSF559615.36E-31304536No hitNo description
CDDcd088751.68E-110306535No hitNo description
SMARTSM002349.1E-33311536IPR002913START domain
PfamPF018525.3E-46312535IPR002913START domain
SuperFamilySSF559611.51E-11555671No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 686 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150415e-59AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014514419.10.0PREDICTED: homeobox-leucine zipper protein ANTHOCYANINLESS 2 isoform X1
SwissprotQ9M2E80.0HDG1_ARATH; Homeobox-leucine zipper protein HDG1
TrEMBLV7BBY40.0V7BBY4_PHAVU; Uncharacterized protein
STRINGGLYMA10G38280.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1